Synthetic peptide within Human BEAN1 aa 163-212 (C terminal). The exact sequence is proprietary. (NP_001171491).Sequence: TDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDT Database link: Q3B7T3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
BEAN1; brain expressed, associated with NEDD4, 1; BEAN; SCA31; protein BEAN1; brain-expressed protein associating with Nedd4 homolog;
BEAN1 (brain expressed, associated with NEDD4, 1) is a protein-coding gene. Diseases associated with BEAN1 include spinocerebellar ataxia 31 , and spinocerebellar ataxia.
Citations
Publication ()
Have you cited DPABH-12477 in a publication? Let us know and earn a reward for your research.
My Review for Anti-BEAN1 (aa 163-212) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
