Synthetic peptide, corresponding to a region within internal sequence amino acids 432-481 (VRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP ) of Human BCL6B (NP_862827).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
BCL6B; B-cell CLL/lymphoma 6, member B (zinc finger protein); B cell CLL/lymphoma 6, member B (zinc finger protein); zinc finger protein 62; ZNF62; BAZF; ZBTB28;
BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. It may function in a narrow stage or be related to some events in the early B-cell development.
Citations
Publication ()
Have you cited DPABH-18857 in a publication? Let us know and earn a reward for your research.
My Review for Anti-BCL6B (aa 432-481) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
