B3GNT3 (NP_055071, 135 a.a. ~ 208 a.a) partial recombinant protein with GST tag. The sequence is KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQ WQETRCANASFVLN
Conjugate
Unconjugated
Target
Alternative Names
B3GNT3; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3; TMEM3; B3GN-T3; B3GNT-3; HP10328; B3GAL-T8; beta3Gn-T3; beta3GalT8; beta-3-Gx-T8; beta-1,3-Gn-T3; beta-1,3-GalTase 8; core1-beta3GlcNAcT; transmembrane protein 3; putative type II memb
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking.
My Review for Anti-B3GNT3 (aa 135-208) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
