Anti-ATP13A1 polyclonal antibody (DPABH-14712)

Rabbit anti-Human ATP13A1 (aa 134-226) polyclonal antibody for IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human ATP13A1 aa 134-226.Sequence: YDPSKATFVKVVPTPNNGSTELVALHRNEGEDGLEVLSFEFQKIKYSYDA LEKKQFLPVAFPVGNAFSYYQSNRGFQEDSEIRAAEKKFGSNK Database link: Q9HD20
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/20 - 1/50;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ATP13A1; ATPase type 13A1; ATP13A; CGI-152; probable cation-transporting ATPase 13A1; cation transporting ATPase
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-14712 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Weingarten, LS; Dave, H; et al. Developmental expression of P-5 ATPase mRNA in the mouse. CELLULAR & MOLECULAR BIOLOGY LETTERS 17:153-170(2012).
Baldridge, R; Ketron, AC; et al. Sub-cellular localization of two P-type ATPases, Atp13a1 and Atp13a2. ABSTRACTS OF PAPERS OF THE AMERICAN CHEMICAL SOCIETY 233:776-776(2007).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket