Synthetic peptide within Mouse AP1S1 aa 98-147 (C terminal). The exact sequence is proprietary.Sequence: VCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDES Database link: P61967.
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
AP1S1; adaptor protein complex AP-1, sigma 1; AP-1 complex subunit sigma-1A; sigma1A-adaptin; sigma-adaptin 1A; HA1 19 kDa subunit; sigma 1a subunit of AP-1 clathrin; clathrin coat assembly protein AP19; adaptor protein complex AP-1 sigma-1A subunit; adap
Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.
My Review for Anti-AP1S1 (aa 98-147) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
