Anti-AP1G2 polyclonal antibody (DPAB-DC3686)

Mouse anti-Human AP1G2 (aa 686-785) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
AP1G2 (NP_003908, 686 a.a. ~ 785 a.a) partial recombinant protein with GST tag. The sequence is RPPENPALLLITITATNFSEGDVTHFICQAAVPKSLQLQLQAPSGNTVPARGGLPITQLFRILNPNKAPLRLKLRLTYDHFHQSVQEIFEVNNLPVESWQ
Conjugate
Unconjugated

Target


Alternative Names
AP1G2; adaptor-related protein complex 1, gamma 2 subunit; G2AD; AP-1 complex subunit gamma-like 2; gamma2-adaptin; clathrin-associated/assembly/adaptor protein, large, gamma-2
Entrez Gene ID
UniProt ID

Product Background


Pathway
Lysosome;

Citations


Have you cited DPAB-DC3686 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Doring, T; Gotthardt, K; et al. gamma 2-Adaptin is functioning in the late endosomal sorting pathway and interacts with ESCRT-I and -III subunits. BIOCHIMICA ET BIOPHYSICA ACTA-MOLECULAR CELL RESEARCH 1803:1252-1264(2010).
Buroker, NE; Huang, JY; et al. The Adaptor-Related Protein Complex 2, Alpha 2 Subunit (AP2 alpha 2) Gene is a Peroxisome Proliferator-Activated Receptor Cardiac Target Gene. PROTEIN JOURNAL 31:75-83(2012).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket