Synthetic peptide within Human ANKRD62 aa 551-600 (C terminal). The exact sequence is proprietary.Sequence: NKGLMKECTLLKERQCQYEKEKEEREVVRRQLQREVDDALNKQLLLEAML Database link: A6NC57-2
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12971 in a publication? Let us know and earn a reward for your research.
Magowan, C; Nunomura, W; et al. Plasmodium falciparum histidine-rich protein 1 associates with the band 3 binding domain of ankyrin in the infected red cell membrane. BIOCHIMICA ET BIOPHYSICA ACTA-MOLECULAR BASIS OF DISEASE 1502:461-470(2000).
Scurr, LL; Guminski, AD; et al. Ankyrin Repeat Domain 1, ANKRD1, a Novel Determinant of Cisplatin Sensitivity Expressed in Ovarian Cancer. CLINICAL CANCER RESEARCH 14:6924-6932(2008).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ANKRD62 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis