Anti-AKAP4 polyclonal antibody (DPAB-DC3668)

Mouse anti-Human AKAP4 (aa 1-100) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. The sequence is MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Conjugate
Unconjugated

Target


Alternative Names
AKAP4; A kinase (PRKA) anchor protein 4; HI; p82; CT99; FSC1
Entrez Gene ID
UniProt ID

Product Background


Pathway
G Protein Signaling Pathways;

Citations


Have you cited DPAB-DC3668 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Agarwal, S; Saini, S; et al. The novel cancer-testis antigen A-kinase anchor protein 4 (AKAP4) is a potential target for immunotherapy of ovarian serous carcinoma. ONCOIMMUNOLOGY 2:-(2013).
Kaneto, M; Krisfalusi, M; et al. Bicarbonate-induced phosphorylation of p270 protein in mouse sperm by cAMP-Dependent protein kinase. MOLECULAR REPRODUCTION AND DEVELOPMENT 75:1045-1053(2008).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket