Rabbit Anti-Human ACSS2 Polyclonal Antibody (DPABH-02407)

Rabbit Anti-Human ACSS2 Polyclonal Antibody for IHC, WB, ICC-IF Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse
Immunogen
Recombinant Protein, antigen sequence: PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
Conjugate
unconjugated

Applications


Application Notes
ICC-IF: 1-4 µg/ml
IHC: 1:50 - 1:200
WB: 4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western blot analysis in human cell line RPMI-8226.

Target


Alternative Names
ACSS2; acyl-CoA synthetase short-chain family member 2; ACS; ACSA; ACAS2; ACECS
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-02407 in a publication? Let us know and earn a reward for your research.

References


Zhang, LW; McCabe, T; et al. An Anti-PCSK9 Antibody Reduces LDL-Cholesterol On Top Of A Statin And Suppresses Hepatocyte SREBP-Regulated Genes. INTERNATIONAL JOURNAL OF BIOLOGICAL SCIENCES 8:310-327(2012).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human ACSS2 Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket