Rabbit Anti-Human ACCS Polyclonal Antibody (DPABH-21526)

Rabbit Anti-Human ACCS Polyclonal Antibody for IHC, WB, ICC-IF Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Mouse, Human, Rat
Immunogen
Recombinant Protein, antigen sequence: NHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYLPKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPG
Conjugate
unconjugated

Applications


Application Notes
ICC-IF: 1-4 µg/ml
IHC: 1:5000 - 1:0000
WB: 4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Target


Alternative Names
ACCS; 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional); ACS; PHACS; 1-aminocyclopropane-1-carboxylate synthase-like protein 1; ACC synthase-like protein 1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-21526 in a publication? Let us know and earn a reward for your research.

References


Prasadam, I; van Gennip, S; et al. ERK-1/2 and p38 in the Regulation of Hypertrophic Changes of Normal Articular Cartilage Chondrocytes Induced by Osteoarthritic Subchondral Osteoblasts. ARTHRITIS AND RHEUMATISM 62:1349-1360(2010).
Bhaijee, F; Pepper, DJ; et al. New developments in the molecular pathogenesis of head and neck tumors: a review of tumor-specific fusion oncogenes in mucoepidermoid carcinoma, adenoid cystic carcinoma, and NUT midline carcinoma. ANNALS OF DIAGNOSTIC PATHOLOGY 15:69-77(2011).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human ACCS Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket