Anti-ACAD11 polyclonal antibody (DPAB-DC3465)

Mouse anti-Human ACAD11 (aa 678-780) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
ACAD11 (NP_115545, 678 a.a. ~ 780 a.a) partial recombinant protein with GST tag. The sequence is RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI
Conjugate
Unconjugated

Target


Alternative Names
ACAD11; acyl-CoA dehydrogenase family, member 11; ACAD-11; acyl-CoA dehydrogenase family member 11; 62113 protein; acyl-Coenzyme A dehydrogenase family, member 11
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC3465 in a publication? Let us know and earn a reward for your research.

References


Gu, JJ; Orr, N; et al. A Genome Scan for Positive Selection in Thoroughbred Horses. PLOS ONE 4:-(2009).
Andresen, BS; Christensen, E; et al. Isolated 2-methylbutyrylglycinuria caused by short/branched-chain acyl-CoA dehydrogenase deficiency: Identification of a new enzyme defect, resolution of its molecular basis, and evidence for distinct acyl-CoA dehydrogenases in isoleucine and valine metabolism. AMERICAN JOURNAL OF HUMAN GENETICS 67:1095-1103(2000).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-ACAD11 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket