Specifications
Immunogen
Recombinant fragment corresponding to Human ABCG5 aa 306-367.Sequence: SVDTQSKEREIETSKRVQMIESAYKKSAICHKTLKNIERMKHLKTLPMVP FKTKDSPGVF SK Database link: 64240
Applications
Application Notes
IHC-P: 1/200 - 1/1000; WB: 1/500 - 1/2000; ELISA: 1/10000; Flow Cyt: 1/200 - 1/400.
Target
Alternative Names
ABCG5; ATP-binding cassette, sub-family G (WHITE), member 5; ATP-binding cassette sub-family G member 5; sterolin 1; STSL; sterolin-1; ATP-binding cassette, subfamily G, member 5;
Product Background
Antigen Description
Transporter that appears to play an indispensable role in the selective transport of the dietary cholesterol in and out of the enterocytes and in the selective sterol excretion by the liver into bile.
Pathway
ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; ABCA transporters in lipid homeostasis, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Fat digestion and absorption, organism-specific biosystem.
Citations
Publication ()
Have you cited DCABH-6172 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
