Anti-AASDH polyclonal antibody (DPABH-14408)

Rabbit anti-Human AASDH (aa 1-232) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment within Human AASDH aa 1-232 (N terminal). The exact sequence is proprietary.Sequence: MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLL LHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHF MKKCNLKYILVEKKQINKFKSFHETLLNYDTFTVEHNDLVLFRLHW
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/3000.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
AASDH; aminoadipate-semialdehyde dehydrogenase; acyl-CoA synthetase family member 4; ACSF4; acyl CoA synthetase family member 4; LYS2
Entrez Gene ID
UniProt ID

Product Background


Gene summary
AASDH (Aminoadipate-Semialdehyde Dehydrogenase) is a Protein Coding gene. GO annotations related to this gene include acid-thiol ligase activity. This gene encodes a member of the non-ribosome peptide syntesase (NRPS) enzyme family. The encoded protein contains an AMP-binding domain, PP-binding (phosphopantetheine, or pantetheine 4'phosphate-binding) domain and the Pyrrolo-quinoline quinon (PQQ) binding domain. The protein is expressed in several adult tissues.
Antigen Description
AASDH is an Acyl CoA synthetase. Acyl CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. The function about AASDH antigen include ATP binding; acid-thiol ligase activity; acyl carrier activity; cofactor binding; ligase activity; nucleotide binding.

Citations


Have you cited DPABH-14408 in a publication? Let us know and earn a reward for your research.

References


Joshi, AK; Zhang, L; et al. Cloning, expression, and characterization of a human 4 '-phosphopantetheinyl transferase with broad substrate specificity. JOURNAL OF BIOLOGICAL CHEMISTRY 278:33142-33149(2003).
HAMMER, T; BODE, R; et al. ENZYMATIC PRODUCTION OF ALPHA-AMINOADIPATE-DELTA-SEMIALDEHYDE AND RELATED-COMPOUNDS BY LYSINE EPSILON-DEHYDROGENASE FROM CANDIDA-ALBICANS. ZENTRALBLATT FUR MIKROBIOLOGIE 147:65-70(1992).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-AASDH polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket