Rabbit Anti-YWHAB Polyclonal antibody (DPABH-19081)

Rabbit Anti-Human YWHAB Polyclonal antibody for IHC, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
YWHAB fusion protein, sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT (1-63 aa encoded by BC010352)
Conjugate
unconjugated

Applications


Application Notes
IHC: 1:20-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
YWHAB; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta; HS1; GW128; YWHAA; KCIP-1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-19081 in a publication? Let us know and earn a reward for your research.

References


McCulloch, RS; Ashwell, MS; et al. Identification of stable normalization genes for quantitative real-time PCR in porcine articular cartilage. JOURNAL OF ANIMAL SCIENCE AND BIOTECHNOLOGY 3:-(2012).
Vazquez-Blomquist, D; Fernandez, JR; et al. Selection of reference genes for use in quantitative reverse transcription PCR assays when using interferons in U87MG. MOLECULAR BIOLOGY REPORTS 39:11167-11175(2012).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-YWHAB Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket