Rabbit Anti-YWHAB Polyclonal antibody (DPABH-19081)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
YWHAB fusion protein, sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT (1-63 aa encoded by BC010352)
Conjugate
Unconjugated

Applications


Application Notes
IHC: 1:20-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
YWHAB; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta; HS1; GW128; YWHAA; KCIP-1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-19081 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Studer, D; Lischer, S; et al. Ribosomal Protein L13a as a Reference Gene for Human Bone Marrow-Derived Mesenchymal Stromal Cells During Expansion, Adipo-, Chondro-, and Osteogenesis. TISSUE ENGINEERING PART C-METHODS 18:761-771(2012).
McCulloch, RS; Ashwell, MS; et al. Identification of stable normalization genes for quantitative real-time PCR in porcine articular cartilage. JOURNAL OF ANIMAL SCIENCE AND BIOTECHNOLOGY 3:-(2012).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket