Showing

Loading...

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Lixisenatide

Full Name :
Lixisenatide
Keywords :
Lixisenatide; Lyxumia; Adlyxin; C215H347N61O65S; ZP10A peptide; AVE0010; AQVE-10010; ZP 10; 320367-13-3; Des-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide; lixisenatida; lixisenatidum; UNII-74O62BB01U; CHEBI:85662; 74O62BB01U; DB09265; DesPro36Exendin-4(1-39)-Lys6-NH2; DesPro38Exendin-4(1-39)-Lys6-NH2; FT-0696481; H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2; H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2; H-L-His-Gly-L-Glu-Gly-L-Thr-L-Phe-L-Thr-L-Ser-L-Asp-L-Leu-L-Ser-L-Lys-L-Gln-L-Met-L-Glu-L-Glu-L-Glu-L-Ala-L-Val-L-Arg-L-Leu-L-Phe-L-Ile-L-Glu-L-Trp-L-Leu-L-Lys-L-Asn-Gly-Gly-L-Pro-L-Ser-L-Ser-Gly-L-Ala-L-Pro-L-Pro-L-Ser-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-L-Lys-NH2
Size: 96T
Species Reactivity: N/A
Application: Quantitative
Detection Sample: serum, plasma
Inquiry Basket