Product Overview
Amino Acid Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGV VHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVK KDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Tag/Conjugate
Unconjugated
Bio-activity
Endogenous alpha-synuclein phosphorylation.
Alternative Names
Active Alpha synuclein PFFs; Active Alpha synuclein aggregates; Alpha synuclein PFF; Active Alpha synuclein protein aggregates; Active Alpha synuclein aggregates; Active Alpha-synuclein protein; Non-A beta component of AD amyloid protein; Non-A4 component of amyloid precursor protein; NACP protein; SNCA protein; NACP protein; PARK1 protein; SYN protein; Parkinson's disease familial 1 Protein; Active Alpha synuclein protein seed; ATTO 594 conjugated alpha synuclein; ATTO labelled alpha synuclein fibrils
Concentration
Batch dependent - please inquire should you have specific requirements
Introduction
Alpha-synuclein (αSyn) is a soluble presynaptic localization protein used in conjunction with the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complex and the chaperone protein cysteine string protein α (CSPα) to facilitate vesicle pool repopulation and vesicle release from the active zone.
Under pathological conditions, this soluble protein undergoes multiple post-translational modifications and forms higher-order oligomers and fibrillar species, resulting in conformationally and biologically distinct inclusions.
These inclusions are known as Lewy bodies (LB) and Lewy neuropils (LN) in Parkinson's disease (PD), PD with dementia (PDD) and Lewy body dementia (DLB), or glial cytoplasmic inclusions (GCI) in multiple system atrophy. In addition, neurodegenerative diseases with αSyn pathology are known as synucleinopathies.
Keywords
Alzheimer's Disease; Neurodegeneration; Neuroscience; Parkinson's Disease; Synuclein; Tangles & Tau
Citations
Publication ()
Have you cited PFF04 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
