Synthetic peptide within Human B3GNT6 aa 191-240 (C terminal). The exact sequence is proprietary.Sequence: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP Database link: Q6ZMB0-2
B3GNT6 synthesizes the core 3 structure of the O glycan, an important precursor in the biosynthesis of mucin type glycoproteins. Plays an important role in the synthesis of mucin type O glycans in digestive organs.
Pathway
Metabolic pathways; Metabolism of proteins; Mucin type O-Glycan biosynthesis; O-glycan biosynthesis, mucin type core; O-linked glycosylation of mucins;
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13844 in a publication? Let us know and earn a reward for your research.
Bisognin, A; Pizzini, S; et al. An integrative framework identifies alternative splicing events in colorectal cancer development. MOLECULAR ONCOLOGY 8:129-141(2014).
Crowell, CK; Qin, Q; et al. Sodium butyrate alters erythropoietin glycosylation via multiple mechanisms. BIOTECHNOLOGY AND BIOENGINEERING 99:201-213(2008).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-B3GNT6 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis