Product Overview
Amino Acid Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEG VVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGF VKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA
Tag/Conjugate
Unconjugated
Alternative Names
Alpha synuclein pre-formed fibrils; Alpha synuclein aggregates; Alpha synuclein protein aggregates; Active Alpha synuclein aggregates; Alpha-synuclein protein; Non-A beta component of AD amyloid protein; Non-A4 component of amyloid precursor protein; NACP protein; SNCA protein; NACP protein; PARK1 protein; SYN protein; Parkison disease familial 1 Protein
Concentration
Batch dependent - please inquire should you have specific requirements
Introduction
Alpha-synuclein (αSyn) is a soluble presynaptic localization protein used in conjunction with the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complex and the chaperone protein cysteine string protein α (CSPα) to facilitate vesicle pool repopulation and vesicle release from the active zone.
Under pathological conditions, this soluble protein undergoes multiple post-translational modifications and forms higher-order oligomers and fibrillar species, resulting in conformationally and biologically distinct inclusions.
These inclusions are known as Lewy bodies (LB) and Lewy neuropils (LN) in Parkinson's disease (PD), PD with dementia (PDD) and Lewy body dementia (DLB), or glial cytoplasmic inclusions (GCI) in multiple system atrophy. In addition, neurodegenerative diseases with αSyn pathology are known as synucleinopathies.
Keywords
Alzheimer's Disease; Neurodegeneration; Neuroscience; Parkinson's Disease; Synuclein; Tangles & Tau
Citations
Publication ()
Have you cited PFF02 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
