Synthetic peptide corresponding to a region within internal sequence amino acids 432 - 481 (SQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHP GIKPYECRECG) of Human ZNF565.
Conjugate
Unconjugated
Applications
Application Notes
WB: 1μg/ml
Target
Alternative Names
ZNF565; zinc finger protein 565; FLJ36991; FLJ36991; Zinc finger protein 565;
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited CABT-BL6057 in a publication? Let us know and earn a reward for your research.
Girard, PM; deRocquigny, H; et al. A model of PSI dimerization: Destabilization of the C-278-G(303) stem-loop by the nucleocapsid protein (NCp10) of MoMuLV. BIOCHEMISTRY 35:8705-8714(1996).
Nagaoka, M; Sugiura, Y; et al. Distinct phosphate backbone contacts revealed by some mutant peptides of zinc finger protein Sp1: Effect of protein-induced bending on DNA recognition. BIOCHEMISTRY 35:8761-8768(1996).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ZNF565 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis