Anti-ZNF236 polyclonal antibody (CABT-BL3883)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
A synthetic peptide corresponding to a region within the internal sequence 1079-1128 (VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEE ETAQLAKIRPQ) of Human ZNF236, NP_031371
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ZNF236; zinc finger protein 236; Regulated by glucose; Zinc finger protein 236; ZNF236A; ZNF236B
Entrez Gene ID
UniProt ID

Citations


Have you cited CABT-BL3883 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Wang, X; Talamantez, JL; et al. A CACCC box in the proximal exon 2 promoter of the rat insulin-like growth factor I gene is required for basal promoter activity. ENDOCRINOLOGY 139:1054-1066(1998).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket