A synthetic peptide corresponding to a region within the internal sequence 1079-1128 (VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEE ETAQLAKIRPQ) of Human ZNF236, NP_031371
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml
Target
Alternative Names
ZNF236; zinc finger protein 236; Regulated by glucose; Zinc finger protein 236; ZNF236A; ZNF236B; regulated by glucose; ZNF236A; ZNF236B;
My Review for Anti-ZNF236 (internal region) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
