Anti-SPCC74.02c polyclonal antibody (CABT-BL3422)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
S. pombe
Immunogen
Fusion protein: VSNNREELPSFRKRSSSSRQSEEIASLQAENAVFSSDPAS NDEKTGNKKRKKKSVSWKPDNDLVQVKFIESLNEEGAASV KTPHIYGNARDMDRQEARVA, corresponding to amino acids 454/553 of S. pombe PAXH.
Conjugate
Unconjugated

Target


Alternative Names
SPCC74.02c; mRNA cleavage and polyadenylation specificity factor complex associated protein; agglutinin-like; hypothetical protein SPCC74.02c; hypothetical serine-rich protein
Entrez Gene ID
UniProt ID

Citations


Have you cited CABT-BL3422 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Liang, SC; Lutz, CS; et al. P54(nrb) is a component of the snRNP-free U1A (SF-A) complex that promotes pre-mRNA cleavage during polyadenylation. RNA-A PUBLICATION OF THE RNA SOCIETY 12:111-121(2006).
Papin, C; Rouget, C; et al. Xenopus Rbm9 is a novel interactor of XGld2 in the cytoplasmic polyadenylation complex. FEBS JOURNAL 275:490-503(2008).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket