HIV type 1 Glycoprotein 120 (Con_A1) [His] (DAG2039)

HIV type 1 Glycoprotein 120 (aa 34 - 518) (Con_A1) [His], recombinant protein from HEK 293 cells Datasheet

Online Inquiry Add to basket

Product Overview
6xHis tagged HIV-1 gp120 (Con_A1/2006) protein (a.a.34-518) ((SEQ: enlwvtvyygvpvwkdaettlfcasdakayetemhnvwathacvptdpnpqeihlenvteefnmwknnmveqm htdiislwdqslkpcvkltplcvtlncsnvnvtnnttntheeeikncsfnmttelrdkkqkvyslfyrldvvq inennsnssyrlincntsaitqacpkvsfepipihycapa
≥ 95%
Each vial contains 100 μg of purified protein in PBS containing 0.1% BSA and 25% glycerol.
1 mg/ml
2-8°C short term, -20°C long term
The human immunodeficiency virus (HIV) is a lentivirus (slowly replicating retrovirus) that causes the acquired immunodeficiency syndrome (AIDS), a condition in humans in which progressive failure of the immune system allows life-threatening opportunistic infections and cancers to thrive. Without treatment, average survival time after infection with HIV is estimated to be 9 to 11 years, depending on the HIV subtype. Infection with HIV occurs by the transfer of blood, semen, vaginal fluid, pre-ejaculate, or breast milk. Within these bodily fluids, HIV is present as both free virus particles and virus within infected immune cells.
Antigen Description
The HIV-1 surface protein gp120, also known as Glycoprotein 120, SU, and gp120 is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM. The surface protein gp120 attaches the virus to the host lymphoid cell by binding to the primary receptor CD4. This interaction induces a structural rearrangement creating a high affinity binding site for a chemokine coreceptor like CXCR4 and/or CCR5. Surface protein gp120 is a ligand for CD209 / DC-SIGN and CLEC4M / DC-SIGNR. It may target the virus to gut-associated lymphoid tissue (GALT) by binding host ITGA4/ITGB7 (alpha-4/beta-7 integrins), a complex that mediates T-cell migration to the GALT. Interaction between gp120 and ITGA4/ITGB7 would allow the virus to enter GALT early in the infection, infecting and killing most of GALT's resting CD4+ T-cells. This T-cell depletion is believed to be the major insult to the host immune system leading to AIDS.
Glycoprotein 120; gp120; SU; Surface protein; HIV1 gp120; Human Immunodeficiency Virus 1 gp120


Have you cited DAG2039 in a publication? Let us know and earn a reward for your research.

Customer Reviews

Write a review, share your experiences with others and get rewarded !

Online Inquiry

Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: HIV type 1 Glycoprotein 120 (Con_A1) [His]

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket