This antibody was developed against recombinant KCNE1B protein corresponding to amino acids: NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:1000 - 1:2500
Target
Alternative Names
AP000322.53; potassium voltage-gated channel subfamily E regulatory subunit 1B; potassium channel, voltage gated subfamily E regulatory beta subunit 1B; putative uncharacterized protein LOC388820; KCNE1B
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
