This antibody was developed against recombinant GID4 protein corresponding to amino acids: DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAF YQYAKSFNSDDFDYE
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:500 - 1:1000
Target
Alternative Names
GID4; GID complex subunit 4; VID24; C17orf39; glucose-induced degradation protein 4 homolog; vacuolar import and degradation 24; GID complex subunit 4, VID24 homolog; vacuolar import and degradation protein 24 homolog;
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
