Anti-C1ORF177 polyclonal antibody (CABT-BL651)


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide, corresponding to a region within internal sequence amino acids 252-301 9SMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPK TPTERIYWANL) of Human C1orf177


Application Notes
WB: 1 μg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
C1ORF177; chromosome 1 open reading frame 177; uncharacterized protein C1orf177; FLJ40201; Uncharacterized protein C1orf177; Chromosome 1 open reading frame 177
Entrez Gene ID
UniProt ID


Have you cited CABT-BL651 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Pelle, R; McOdimba, F; et al. The African trypanosome cyclophilin A homologue contains unusual conserved central and N-terminal domains and is developmentally regulated. GENE 290:181-191(2002).

Online Inquiry

Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket