Rabbit Anti-Human EIF3E Polyclonal Antibody (DPABH-25989)

Rabbit Anti-Human EIF3E Polyclonal Antibody for IHC, WB, ICC-IF Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
Recombinant Protein, antigen sequence: ARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Conjugate
unconjugated

Applications


Application Notes
ICC-IF: 1-4 µg/ml
IHC: 1:20 - 1:50
WB: 4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine cells.
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF3E antibody. Remaining relative intensity is presented.

Target


Alternative Names
EIF3E; eukaryotic translation initiation factor 3, subunit E; INT6; EIF3S6; EIF3-P48; eIF3-p46
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-25989 in a publication? Let us know and earn a reward for your research.

References


Buda, P; Reinbothe, T; et al. Eukaryotic Translation Initiation Factor 3 Subunit E Controls Intracellular Calcium Homeostasis by Regulation of Cav1.2 Surface Expression. PLOS ONE 8:-(2013).
Bandyopadhyay, A; Lakshmanan, V; et al. Moe1 and spInt6, the fission yeast homologues of mammalian translation initiation factor 3 Subunits p66 (eIF3d) and p48 (eIF3e), respectively, are required for stable association of eIF3 Subunits. JOURNAL OF BIOLOGICAL CHEMISTRY 277:2360-2367(2002).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human EIF3E Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket