Synthetic peptide within Human ZFP38 aa 61-110 (internal sequence). The exact sequence is proprietary. (NP_666019)Sequence: EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCP Database link: Q9Y5A6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
ZSCAN21; zinc finger and SCAN domain containing 21; ZNF38; Zipro1; NY-REN-21; zinc finger and SCAN domain-containing protein 21; zfp-38; zinc finger protein 38 homolog; zinc finger protein 38 (KOX 25); renal carcinoma antigen NY-REN-21; zinc finger protei
My Review for Anti-ZSCAN21 (aa 61-110) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
