Synthetic peptide within Human ZFP38 aa 61-110 (internal sequence). The exact sequence is proprietary. (NP_666019)Sequence: EALSQLRVLCCEWLRPEIHTKEQILELLVLEQFLTILPQELQAWVQEHCP Database link: Q9Y5A6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
ZSCAN21; zinc finger and SCAN domain containing 21; ZNF38; Zipro1; NY-REN-21; zinc finger and SCAN domain-containing protein 21; zfp-38; zinc finger protein 38 homolog; zinc finger protein 38 (KOX 25); renal carcinoma antigen NY-REN-21; zinc finger protei
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13155 in a publication? Let us know and earn a reward for your research.
Carneiro, FRG; Silva, TCL; et al. Spectroscopic characterization of the tumor antigen NY-REN-21 and identification of heterodimer formation with SCAND1. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS 343:260-268(2006).
Ecker, K; Lorenz, A; et al. A RAS recruitment screen identifies ZKSCAN4 as a glucocorticoid receptor-interacting protein. JOURNAL OF MOLECULAR ENDOCRINOLOGY 42:105-117(2009).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ZSCAN21 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis