Synthetic peptide within Human ZNF780B aa 1-50 (N terminal). The exact sequence is proprietary.Sequence: MVHGSVTFRDVAIDFSQEEWECLQPDQRTLYRDVMLENYSHLISLGSSIS Database link: Q9Y6R6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ZNF780B; zinc finger protein 780B; zinc finger protein 779; ZNF779; zinc finger protein 779; ZNF779;
ZNF780B belongs to the krueppel C2H2-type zinc-finger protein family. It contains 23 C2H2-type zinc fingers and 1 KRAB domain. ZNF780B may be involved in transcriptional regulation.
Citations
Publication ()
Have you cited DPABH-13082 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZNF780B (aa 1-50) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
