Anti-ZNF614 polyclonal antibody (DPABH-07635)

Mouse anti-Human ZNF614 (full length) polyclonal antibody for ICC/IF, WB

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human ZNF614 aa 1-198. ENSP00000348674.5.Sequence: MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQ TSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKS VQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRH GINNPVEFIGETGS
Conjugate
Unconjugated

Applications


Application Notes
ICC/IF: 10 μg/ml; WB: 1/500 - 1/1000.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ZNF614; zinc finger protein 614; FLJ21941; MGC120638
Entrez Gene ID
UniProt ID

Product Background


Pathway
Gene Expression; Generic Transcription Pathway;

Citations


Have you cited DPABH-07635 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


MOWSZOWICZ, I; LEE, HJ; et al. A POINT MUTATION IN THE 2ND ZINC-FINGER OF THE DNA-BINDING DOMAIN OF THE ANDROGEN RECEPTOR GENE CAUSES COMPLETE ANDROGEN INSENSITIVITY IN 2 SIBLINGS WITH RECEPTOR-POSITIVE ANDROGEN RESISTANCE. MOLECULAR ENDOCRINOLOGY 7:861-869(1993).
Sevinc, A; Fung, LWM; et al. NON-ERYTHROID BETA SPECTRIN INTERACTING PROTEINS AND THEIR EFFECTS ON SPECTRIN TETRAMERIZATION. CELLULAR & MOLECULAR BIOLOGY LETTERS 16:595-609(2011).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket