Anti-ZNF407 polyclonal antibody (DPABH-15048)

Rabbit Anti-Human ZNF407 (aa 2000-2050) polyclonal antibody for IP

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human ZNF407 aa 2000-2050. The exact sequence is proprietary. NP_060227.2Sequence: GEVEGRAGLEEQGRPGAKDVLIQLPGQEVSHVAADPEAPEIQMFPQAQES P Database link: Q9C0G0
Conjugate
Unconjugated

Applications


Application Notes
IP: 2-10 μg/mg
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ZNF407; zinc finger protein 407; FLJ13839; FLJ20307; KIAA1703
Entrez Gene ID
UniProt ID

Product Background


Gene summary
ZNF407 (Zinc Finger Protein 407) is a Protein Coding gene. Diseases associated with ZNF407 include non-syndromic intellectual disability and syndromic intellectual disability. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is REST. This gene encodes a zinc finger protein whose exact function is not known. It may be involved in transcriptional regulation. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Antigen Description
May be involved in transcriptional regulation. The function about ZNF407 antigen include DNA binding; metal ion binding; zinc ion binding.

Citations


Have you cited DPABH-15048 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Chiba, M; Katayama, K; et al. Diuretics aggravate zinc deficiency in patients with liver cirrhosis by increasing zinc excretion in urine. HEPATOLOGY RESEARCH 43:365-373(2013).
Otani, K; Ujike, H; et al. The ZDHHC8 gene did not associate with bipolar disorder or schizophrenia. NEUROSCIENCE LETTERS 390:166-170(2005).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket