Synthetic peptide within Human ZNF184 aa 1-50 (N terminal). The exact sequence is proprietary. NP_009080.2Sequence: MEDLSSPDSTLLQGGHNLLSSASFQEAVTFKDVIVDFTQEEWKQLDPGQR Database link: Q99676
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/2000 - 1/10000; IP: 2-10 μg/mg;
Target
Alternative Names
ZNF184; zinc finger protein 184; zinc finger protein 184 (Kruppel-like);
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12070 in a publication? Let us know and earn a reward for your research.
Alonzo, ES; Gottschalk, RA; et al. Development of Promyelocytic Zinc Finger and ThPOK-Expressing Innate gamma delta T Cells Is Controlled by Strength of TCR Signaling and Id3. JOURNAL OF IMMUNOLOGY 184:1268-1279(2010).
Li, G; Chen, N; et al. Complete coding sequences of the rabbitpox virus genome. JOURNAL OF GENERAL VIROLOGY 86:2969-2977(2005).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ZNF184 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis