Rabbit Anti-UBB Polyclonal antibody (DPABH-22055)

Rabbit Anti-Human UBB Polyclonal antibody for WB, IP, IHC, IF, CoIP, ELISA

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat, Arabidopsis thaliana, Monkey, T. cruzi
Immunogen
ubiquitin fusion protein, sequence: KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC (103-229 aa encoded by BC000379)
Conjugate
Unconjugated

Applications


Application Notes
WB: 1:500-1:1000
IP: 0.5-4.0 ug for IP and 1:200-1:1000 for WB
IHC: 1:50-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
UBB; ubiquitin B; polyubiquitin-B; polyubiquitin B
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-22055 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Mutant ubiquitin UBB+1 is accumulated in sporadic inclusion-body myositis muscle fibers

NEUROLOGY

Authors: Fratta, P; Engel, WK; Van Leeuwen, FW; Hol, EM; Vattemi, G; Askanas, V

Mutant ubiquitin (UBB+1), a product of "molecular misreading," is toxic to cells because its ubiquitinated form inhibits the proteasome, contributing to accumulation of misfolded proteins and their ensuing toxicity. The authors demonstrate in 10 sporadic inclusion body myositis (s-IBM) muscle biopsies that UBB+1 is accumulated in aggregates containing amyloid-beta and phosphorylated-tau. In s-IBM, UBB+1 may be pathogenic by inhibiting proteasome, thereby promoting accumulation of cytotoxic misfolded amyloid-beta and phosphorylated-tau.

Regulation and control of thermally activated building systems (TABS)

BAUPHYSIK

Authors: Toedtli, Juerg; Gwerder, Markus; Renggli, Franz; Guentensperger, Werner; Lehmann, Beat; Dorer, Viktor; Hildebrand, Kurt

Regulation and control of thermally activated building systems (TABS). Thermally activated building systems (TABS) are becoming increasingly important in terms of energy efficient cooling and heating of buildings. In practice, however regulation and control of such systems often causes problems. Started five years ago with the aim of getting to grips with these problems, the TABS Control research project was completed in early 2009. The project yielded the following results: various models and simulation programs for TABS; performance-bound calculations for regulating zones; a range of zone regulation/control strategies for planners to choose from, including good solutions for automatic switching between heating and cooling, for pulsed operation of the zone pump and for room temperature control,, the implementation of a subset of these strategies as standard solutions in a Siemens building automation system, laboratory tests on these strategies; a new procedure for the integrated planning of TABS and their regulation/control (referred to as UBB planning procedure - Unknown But Bounded); an Excel planning tool, guidelines on selecting the hydraulic switching topology; a method for operation optimization,- the theoretical basis for the new integrated planning procedure and the new regulation/control strategies; a patent application.

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket