Anti-TMPRSS3 monoclonal antibody (DCABH-6670)

Specifications


Host Species
Mouse
Antibody Isotype
IgG2b
Clone
F8
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human TMPRSS3 aa 221-317.Sequence: NMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTI QVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFN Database link: P57727
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/1000 - 1/5000;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TMPRSS3; transmembrane protease, serine 3; DFNB8, DFNB10; transmembrane protease serine 3; serine protease TADG-12; tumor-associated differentially-expressed gene 12 protein
Entrez Gene ID
UniProt ID

Citations


Have you cited DCABH-6670 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket