Anti-TMEM69 polyclonal antibody (DPABH-22102)

Rabbit anti-Human TMEM69 (aa 131-180) polyclonal antibody for WB, IHC-P Datasheet

Online Inquiry Add to basket   


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide corresponding to a region within internal amino acids 131-180 (AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLIS E) of Human TMEM69 (NP_057570).


Application Notes
WB: 0.5 μg/ml; IHC-P: 4 - 8 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
TMEM69; transmembrane protein 69; C1orf154
Entrez Gene ID
UniProt ID

Product Background

Antigen Description
TMEM69 (transmembrane protein 69) is a protein-coding gene.


Have you cited DPABH-22102 in a publication? Let us know and earn a reward for your research.


Kao, YR; Shih, JY; et al. Tumor-associated antigen L6 and the invasion of human lung cancer cells. CLINICAL CANCER RESEARCH 9:2807-2816(2003).
Chen, CH; Greenberg, ML; et al. Monoclonal antibodies that bind to the core of fusion-active glycoprotein 41. AIDS RESEARCH AND HUMAN RETROVIRUSES 16:2037-2041(2000).

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !

Online Inquiry

Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-TMEM69 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket