Anti-TMEM69 polyclonal antibody (DPABH-22102)

Rabbit anti-Human TMEM69 (aa 131-180) polyclonal antibody for WB, IHC-P Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide corresponding to a region within internal amino acids 131-180 (AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLIS E) of Human TMEM69 (NP_057570).
Conjugate
Unconjugated

Applications


Application Notes
WB: 0.5 μg/ml; IHC-P: 4 - 8 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TMEM69; transmembrane protein 69; C1orf154
Entrez Gene ID
UniProt ID

Product Background


Antigen Description
TMEM69 (transmembrane protein 69) is a protein-coding gene.

Citations


Have you cited DPABH-22102 in a publication? Let us know and earn a reward for your research.

References


DAS, T; BAEK, KJ; et al. EVIDENCE THAT THE G(H) PROTEIN IS A SIGNAL MEDIATOR FROM ALPHA(1)-ADRENOCEPTOR TO A PHOSPHOLIPASE-C .2. PURIFICATION AND CHARACTERIZATION OF A G(H)-COUPLED 69-KDA PHOSPHOLIPASE-C AND RECONSTITUTION OF ALPHA(1)-ADRENOCEPTOR, G(H) FAMILY, AND PHOSPHOLIPASE-C. JOURNAL OF BIOLOGICAL CHEMISTRY 268:27398-27405(1993).
Han, SM; Sanfacon, H; et al. Tomato ringspot virus proteins containing the nucleoside triphosphate binding domain are transmembrane proteins that associate with the endoplasmic reticulum and cofractionate with replication complexes. JOURNAL OF VIROLOGY 77:523-534(2003).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-TMEM69 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket