Synthetic peptide within Human TMEM182 aa 67-116 (N terminal). The exact sequence is proprietary. NP_653233Sequence: ENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFW Database link: Q6ZP80
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12410 in a publication? Let us know and earn a reward for your research.
Kim, YK; Kim, Y; et al. Identification of a genetic variant at 2q12.1 associated with blood pressure in East-Asians by genome-wide scan including gene-environment interactions. BMC MEDICAL GENETICS 15:-(2014).
Wales, S; Hashemi, S; et al. Global MEF2 target gene analysis in cardiac and skeletal muscle reveals novel regulation of DUSP6 by p38MAPK-MEF2 signaling. NUCLEIC ACIDS RESEARCH 42:11349-11362(2014).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-TMEM182 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis