DKFZP434L1717 (NP_115512, 59 a.a. ~ 120 a.a) partial recombinant protein with GST tag. The sequence is YKQTDPEHPDNDRFILSRGHAAPILYAAWVEVGDISESDLLNLRKLHSDLERHPTPRLPF VD
Conjugate
Unconjugated
Target
Alternative Names
TKTL2; transketolase-like 2; transketolase-like protein 2;
TKTL2 (transketolase-like 2) is a protein-coding gene. Diseases associated with TKTL2 include wernicke-korsakoff syndrome, and laryngeal squamous cell carcinoma, and among its related super-pathways are pentose phosphate pathway and Biosynthesis of amino acids. GO annotations related to this gene include metal ion binding and transketolase activity. An important paralog of this gene is TKTL1.
My Review for Anti-TKTL2 (aa 59-120) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
