Anti-THUMPD1 polyclonal antibody (DPABH-14100)

Rabbit anti-Human THUMPD1 (aa 304-353) polyclonal antibody for WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human THUMPD1 aa 304-353 (C terminal). The exact sequence is proprietary.Sequence: KNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDFS Database link: Q9NXG2
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
THUMPD1; THUMP domain containing 1; THUMP domain-containing protein 1; FLJ20274; DKFZp686C1054
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-14100 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Armengaud, J; Urbonavicius, J; et al. N-2-methylation of guanosine at position 10 in tRNA is catalyzed by a THUMP domain-containing, S-adenosylmethionine-dependent methyltransferase, conserved in Archaea and Eukaryota. JOURNAL OF BIOLOGICAL CHEMISTRY 279:37142-37152(2004).
Gabant, G; Auxilien, S; et al. THUMP from archaeal tRNA : m(2)(2)G10 methyltransferase, a genuine autonomously folding domain. NUCLEIC ACIDS RESEARCH 34:2483-2494(2006).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket