Anti-TDGF1 polyclonal antibody (DPABH-12803)

Rabbit Anti-Human TDGF1 (aa 100-150) polyclonal antibody for WB, FC, ICC/IF

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Mouse, Human
Immunogen
Synthetic peptide within Human Cripto1 aa 100-150 (internal sequence). The exact sequence is proprietary.Sequence: SFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGC D Database link: P13385
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/1000 - 1/2000; Flow Cyt: 1/50; ICC/IF: 1/20 - 1/100;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; cripto-1 growth factor
Entrez Gene ID
UniProt ID

Product Background


Pathway
Developmental Biology; POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation; Signaling by NODAL;

Citations


Have you cited DPABH-12803 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Fang, ZF; Gai, H; et al. Rabbit embryonic stem cell lines derived from fertilized, parthenogenetic or somatic cell nuclear transfer embryos. EXPERIMENTAL CELL RESEARCH 312:3669-3682(2006).
Adewumi, O; Aflatoonian, B; et al. Characterization of human embryonic stem cell lines by the International Stem Cell Initiative. NATURE BIOTECHNOLOGY 25:803-816(2007).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket