Anti-TBC1D7 polyclonal antibody (DPABH-13946)

Rabbit Anti-Human TBC1D7 (aa 111-160) polyclonal antibody for WB


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human TBC1D7 aa 111-160 (internal sequence). The exact sequence is proprietary.Sequence: MYQLESGKLPRSPSFPLPKAFEQYLNLEDGRLLTHLRMCSAAPKLPYDLW Database link: Q9P0N9-4


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
TBC1D7; TBC1 domain family, member 7; TBC1 domain family member 7; dJ257A7.3; FLJ32666; cell migration-inducing protein 23
Entrez Gene ID
UniProt ID


Have you cited DPABH-13946 in a publication? Let us know and earn a reward for your research.

Related Products

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Roberts, T; Chernova, O; et al. NB4S, a member of the TBC1 domain family of genes, is truncated as a result of a constitutional t(1;10)(p22;q21) chromosome translocation in a patient with stage 4S neuroblastoma. HUMAN MOLECULAR GENETICS 7:1169-1178(1998).
Pehmoller, C; Brandt, N; et al. Exercise Alleviates Lipid-Induced Insulin Resistance in Human Skeletal Muscle-Signaling Interaction at the Level of TBC1 Domain Family Member 4. DIABETES 61:2743-2752(2012).

Online Inquiry

Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket