Anti-TBC1D2 polyclonal antibody (DPABH-12058)

Rabbit anti-Human TBC1D2 (aa 1-50) polyclonal antibody for WB, IP

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human TBC1D2 aa 1-50 (N terminal). The exact sequence is proprietary.Sequence: MEGAGENAPESSSSAPGSEESARDPQVPPPEEESGDCARSLEAVPKKLCG Database link: Q9BYX2
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/2000 - 1/10000; IP: 2-10 μg/mg lysate.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TBC1D2; TBC1 domain family, member 2; TBC1 domain family member 2A; Armus; PARIS1; prostate antigen recognized and identified by SEREX
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-12058 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Funai, K; Cartee, GD; et al. Inhibition of Contraction-Stimulated AMP-Activated Protein Kinase Inhibits Contraction-Stimulated Increases in PAS-TBC1D1 and Glucose Transport Without Altering PAS-AS160 in Rat Skeletal Muscle. DIABETES 58:1096-1104(2009).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket