Anti-SOCS7 polyclonal antibody (DPABH-13950)

Rabbit anti-Human SOCS7 (aa 3-52) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Synthetic peptide within Human SOCS7 aa 3-52 (N terminal). The exact sequence is proprietary. Isoform 2.Sequence: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS Database link: O14512-2
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
SOCS7; suppressor of cytokine signaling 7; NAP4; Nck; Ash and phospholipase C binding protein; NCK associated protein 4
Entrez Gene ID
UniProt ID

Product Background


Pathway
ECS complex; Jak-STAT signaling pathway;

Citations


Have you cited DPABH-13950 in a publication? Let us know and earn a reward for your research.

References


Kornbluth, RS; Stone, GW; et al. Immunostimulatory combinations: designing the next generation of vaccine adjuvants. JOURNAL OF LEUKOCYTE BIOLOGY 80:1084-1102(2006).
Bocangel, D; Zheng, M; et al. Combinatorial synergy induced by adenoviral-mediated mda-7 and Herceptin in Her-2+breast cancer cells. CANCER GENE THERAPY 13:958-968(2006).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-SOCS7 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket