Anti-SLC7A9 polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Recombinant protein corresponding to amino acids of human SLC7A9. The sequence is YKFGWAQKISKPITMHLQMLMEVVPPEEDPE

Conjugate

Application Notes

IHC: 1:1000-1:2500; IF: 1-4 μg/mL. & The optimal working dilution should be determined by the end user.

Alternative Names

SLC7A9; solute carrier family 7 (amino acid transporter light chain, bo,+ system), member 9; BAT1; CSNU3; B(0,+)-type amino acid transporter 1; b(0,+)AT; glycoprotein-associated amino acid transporter b0,+AT1; solute carrier family 7 (cationic amino acid

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in the reabsorption of cystine in the kidney tubule. Mutations in this gene cause non-type I cystinuria, a disease that leads to cystine stones in the urinary system due to impaired transport of cystine and dibasic amino acids. Alternate transcript variants, which encode the same protein, have been found for this gene.

Pathway

Amino acid transport across the plasma membrane; Cell surface interactions at the vascular wall; Protein digestion and absorption; SLC-mediated transmembrane transport