SLC1A6 (NP_005062, 500 a.a. ~ 564 a.a) partial recombinant protein with GST tag. The sequence is LDRLRTMTNVLGDSIGAAVIEHLSQRELELQEAELTLPSLGKPYKSLMAQEKGASRGRGG NESAM
Conjugate
Unconjugated
Target
Alternative Names
SLC1A6; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6; EAAT4; excitatory amino acid transporter 4; solute carrier family 1 member 6; sodium-dependent glutamate/aspartate transporter;
SLC1A6 (solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6) is a protein-coding gene. Diseases associated with SLC1A6 include ossifying fibromyxoid tumor, and early myoclonic encephalopathy, and among its related super-pathways are Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell and Amino acid transport across the plasma membrane. GO annotations related to this gene include L-aspartate transmembrane transporter activity and L-glutamate transmembrane transporter activity. An important paralog of this gene is SLC1A3.
Pathway
Glutamate Neurotransmitter Release Cycle; Glutamatergic synapse; Neurotransmitter Release Cycle; Transmembrane transport of small molecules.
Citations
Publication ()
Have you cited DPAB-DC2885 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC1A6 (aa 500-564) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
