Anti-SLC19A2 polyclonal antibody (DPABH-09920)

Mouse anti-Human SLC19A2 (full length) polyclonal antibody for WB

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human SLC19A2 aa 1-497. (NP_008927.1).Sequence: MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSE PFLTPYLLGPDKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPV VLLQGLSLIVTWFMLLYAQGLLAIQFLEFFYGIATATEIAYYSYIYSVVD LGMYQKVTSYCRSATLV
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
SLC19A2; solute carrier family 19 (thiamine transporter), member 2; TRMA; thiamine transporter 1; THTR1; thTr-1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Metabolism; Metabolism of vitamins and cofactors; Metabolism of water-soluble vitamins and cofactors; Vitamin B1 (thiamin) metabolism; Vitamin digestion and absorption;

Citations


Have you cited DPABH-09920 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Reidling, JC; Said, HM; et al. In vitro and in vivo characterization of the minimal promoter region of the human thiamin transporter SLC19A2. AMERICAN JOURNAL OF PHYSIOLOGY-CELL PHYSIOLOGY 285:C633-C641(2003).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket