Anti-SIDT2 polyclonal antibody (DPABH-14788)

Rabbit anti-Human SIDT2 (aa 227-291) polyclonal antibody for IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human SIDT2 aa 227-291.Sequence: KKAAITVQRKDFPSNSFYVVVVVKTEDQACGGSLPFYPFAEDEPVDQGHR QKTLSVLVSQAVTSE Database link: Q8NBJ9
Conjugate
Unconjugated

Applications


Application Notes
IHC-P: 1/50 - 1/200.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
SIDT2; SID1 transmembrane family, member 2; SID1 transmembrane family member 2; CGI 40; CGI-40; FLJ90656
Entrez Gene ID
UniProt ID

Product Background


Antigen Description
SIDT2 (SID1 transmembrane family, member 2) is a protein-coding gene. GO annotations related to this gene include RNA transmembrane transporter activity. An important paralog of this gene is SIDT1.

Citations


Have you cited DPABH-14788 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket