Rabbit Anti-Human SEPT4 Polyclonal Antibody (DPABH-25970)

Rabbit Anti-Human SEPT4 Polyclonal Antibody for IHC, WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: YDDDLEFRPPSRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKS
Conjugate
unconjugated

Applications


Application Notes
IHC: 1:20 - 1:50
WB: 0.4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human cerebral cortex shows high expression.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Target


Alternative Names
SEPT4; septin 4; H5; ARTS; MART; SEP4
Entrez Gene ID
UniProt ID

Product Background


Gene summary
SEPT4 (Septin 4) is a Protein Coding gene. Diseases associated with SEPT4 include artemis deficiency and parkinson disease, late-onset. Among its related pathways are ERK Signaling and Actin Nucleation by ARP-WASP Complex. GO annotations related to this gene include GTP binding and structural molecule activity. An important paralog of this gene is SEPT6. This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer.
Antigen Description
Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). May play a role in platelet secretion. Isoform ARTS, but not the other isoforms, is required for the induction of cell death mediated by TGF-beta and by other apoptotic stimuli. Septin-4 is a protein that in humans is encoded by the SEPT4 gene. This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. The protein encoded by this gene is thought to be part of a complex involved in cytokinesis. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. The function about SEPT4 antigen include GTP binding; GTPase activity; protein binding; structural molecule activity.

Citations


Have you cited DPABH-25970 in a publication? Let us know and earn a reward for your research.

References


Pache, M; Zieger, B; et al. Immunoreactivity of the septins SEPT4, SEPT5, and SEPT8 in the human eye. JOURNAL OF HISTOCHEMISTRY & CYTOCHEMISTRY 53:1139-1147(2005).
Sugino, Y; Ichioka, K; et al. Septins as Diagnostic Markers for a Subset of Human Asthenozoospermia. JOURNAL OF UROLOGY 180:2706-2709(2008).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human SEPT4 Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket