SEC22L3 (NP_116752, 3 a.a. ~ 68 a.a) partial recombinant protein with GST tag. The sequence is VIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHF SSFGDV
Conjugate
Unconjugated
Target
Alternative Names
SEC22C; SEC22 vesicle trafficking protein homolog C (S. cerevisiae); SEC22L3; vesicle-trafficking protein SEC22c; secretion deficient 22C; SEC22 vesicle trafficking protein-like 3;
This gene encodes a member of the SEC22 family of vesicle trafficking proteins. The encoded protein is localized to the endoplasmic reticulum and may play a role in the early stages of ER-Golgi protein trafficking. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Citations
Publication ()
Have you cited DPAB-DC3730 in a publication? Let us know and earn a reward for your research.
Q: Does the DPAB-DC3730's buffer contain sodium azide?
A: None
Customer Reviews
My Review for Anti-SEC22C (aa 3-68) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
