Anti-SARS-CoV Polyclonal antibody (DPATB-H83537)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
SARS-CoV
Immunogen
Synthetic peptide: TNHGHKVVEL VAEMDGIQYG RSGITLGVLV PHVGETPIAY RNVLLRKNGN KGAGGHSYGI DLKSYDLGDE LGTDPIEDYE QNWNTKHGSG ALRELTRELN , corresponding to amino acids 79-180 of SARS TNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAY RNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDY
Conjugate
Unconjugated

Target


Alternative Names
Human SARS coronavirus,ORF1ab polyprotein,Replicase polyprotein 1ab,

Citations


Have you cited DPATB-H83537 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Kondratowicz, AS; Lennemann, NJ; et al. T-cell immunoglobulin and mucin domain 1 (TIM-1) is a receptor for Zaire Ebolavirus and Lake Victoria Marburgvirus. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 108:8426-8431(2011).
Prabakaran, P; Zhu, ZY; et al. Potent Human Monoclonal Antibodies against SARS CoV, Nipah and Hendra Viruses (vol 9, pg 355, 2009). EXPERT OPINION ON BIOLOGICAL THERAPY 9:533-533(2009).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket