Anti-SARS-CoV Nsp7 Polyclonal antibody (DPATB-H83541)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
SARS-CoV
Immunogen
Fusion protein: TNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCT VCGMWKGYGCSCDQLREPLMQ, corresponding to amino acids 39/139 of SARS Nsp7. TNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR CHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCT VC
Conjugate
Unconjugated

Target


Alternative Names
GFL,Growth factor like peptide,

Product Background


Antigen Description
SARS is not claimed to have been eradicated (unlike smallpox), as it may still be present in its natural host reservoirs (animal populations) and may return to the human population.

Citations


Have you cited DPATB-H83541 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Zhai, YJ; Sun, F; et al. Insights into SARS-CoV transcription and replication from the structure of the nsp7-nsp8 hexadecamer. NATURE STRUCTURAL & MOLECULAR BIOLOGY 12:980-986(2005).
Ramachandran, S; Jain, P; et al. Mining from complete proteomes to identify adhesins and adhesin-like proteins: A rapid aid to experimental researchers. Proceedings of the Fourth International Conference on Bioinformatics of Genome Regulation and Structure, Vol 1 :351-354(2004).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket