Anti-SARS-CoV Nsp10 Polyclonal antibody (DPATB-H83542)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
SARS-CoV
Immunogen
Fusion protein: TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSE YDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRD LYDKLQFTSLEIPRRNVATLQ, corresponding to amino acids 500/601 of SARS Nsp10. TRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSE YDYVIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRD
Conjugate
Unconjugated

Target


Alternative Names
GFL,Growth factor like peptide,Hel,Helicase,Non structural protein 10,Nsp10,

Product Background


Antigen Description
Nsp10 has helicase activity and contains a zinc finger structure that displays RNA and DNA duplex-unwinding activities with 5' to 3' polarity. Its ATPase activity is strongly stimulated by poly(U), poly(dT), poly(C), poly(dA), but not by poly(G). Activity.

Citations


Have you cited DPATB-H83542 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Woo, PCY; Lau, SKP; et al. Phylogenetic and recombination analysis of coronavirus HKU1, a novel coronavirus from patients with pneumonia. ARCHIVES OF VIROLOGY 150:2299-2311(2005).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket